CDK6_HUMAN   Q00534


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q00534

Recommended name:Cyclin-dependent kinase 6

EC number:EC:2.7.11.22

Alternative names:(Cell division protein kinase 6) (Serine/threonine-protein kinase PLSTIRE)

Cleaved into:

GeneID:1021

Gene names  (primary ):CDK6

Gene names  (synonym ):CDKN6

Gene names  (ORF ):

Length:326

Mass:36938

Sequence:MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA

Tissue specificity:Expressed ubiquitously. Accumulates in squamous cell carcinomas, proliferating hematopoietic progenitor cells, beta-cells of pancreatic islets of Langerhans, and neuroblastomas. Reduced levels in differentiating cells. {ECO:0000269|PubMed:20668294, ECO:0000269|PubMed:8114739}.

Induction:Down-regulated in response to enterovirus 71 (EV71) infection. Induced by NANOG during S-phase entry. {ECO:0000269|PubMed:16548883, ECO:0000269|PubMed:19139263}.

Developmental stage:

Protein families:Protein kinase superfamily, CMGC Ser/Thr protein kinase family, CDC2/CDKX subfamily


   💬 WhatsApp