ASIC5_MOUSE Q9R0Y1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9R0Y1
Recommended name：Acid-sensing ion channel 5
EC number：
Alternative names：(ASIC5) (Amiloride-sensitive cation channel 5) (Brain-liver-intestine amiloride-sensitive Na(+) channel) (BLINaC)
Cleaved into：
GeneID：58170
Gene names (primary )：Asic5
Gene names (synonym )：Accn5 Blinac
Gene names (ORF )：
Length：495
Mass：56523
Sequence：MEHTEKSQVHAEKGLLGKIKRYLSKRPLPSPTDRKKFDQDFAMSTSFHGIHNIAQNQNKVRKVIWLAVVLGSVSLLVWQIYSRLVNYFTWPTTTSIEVQYVEKIEFPAVTLCNLNRFQTEAVSRFGIIFFLWDIVSKVLRLQEISANNTGSPETLDFVTNHQNFSITEFVKNNGFYLNNDTLVHCEFFGKTCSPKDFKHVFTEYGNCFTFNYGENIQNKNKVSVSGRGLKLLLDVHQEEFTDNPVPGFADAGVIFVIHSPKKEPQFDGLGLSSPVGMHARVTIRQLKTVHQEYPWGECNPNIKLRNFITYSTYGCLKECKARHIQRLCGCLPFLLPGNGVECDLLEYYNCVSPILDHIERKGLCTMGTHNSSCPVSCEETEYPATVSYSTFPSQRATRFLAKKLNQSQEYIRENLVNIEINYSDLNYKITQQQKAVSVPELLADVGGQLGLFCGASLITIIEIIEYFFTNFYWVLIFFLLKILETIQRTSPPQAV
Tissue specificity：Detected in cerebellum, brainstem, kidney, liver, hepatocytes, lung, intestine and embryo. In the cerebellum. restricted to interneurons in the granular layer, specifically in GRM1-expressing unipolar brush cells of the vestibulocerebellum. {ECO:0000269|PubMed:10457052, ECO:0000269|PubMed:24663811}.
Induction：
Developmental stage：
Protein families：Amiloride-sensitive sodium channel (TC 1.A.6) family, ASIC5 subfamily