GLO2_RAT O35952
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O35952
Recommended name：Hydroxyacylglutathione hydrolase, mitochondrial
EC number：EC:3.1.2.6
Alternative names：Glyoxalase II (Glx II) Round spermatid protein RSP29
Cleaved into：
GeneID：
Gene names (primary )：Hagh
Gene names (synonym )：Rsp29
Gene names (ORF )：
Length：309
Mass：34,109
Sequence：MVLGRGSLCLRSLSVLGAACARRGLGQALLGLSLCHTDFRKNLTVQQDMMKIELLPALTDNYMYLIIDEDTQEAAVVDPVQPQKVIETVKKHRVKLTTVLTTHHHWDHAGGNEKLVKLEPGLKVYGGDDRIGALTHKVTHLSTLEVGSLSVKCLSTPCHTSGHICYFVSKPGSSEPSAVFTGDTLFVAGCGKFYEGTADEMYKALLEVLGRLPPDTKVICGHEYTVNNLKFARHVEPGNTAVQEKLAWAKEKNAIGEPTVPSTLAEEFTYNPFMRVKEKTVQQHAGETDPVTTMRAIRREKDQFKVPRD
Tissue specificity：Strongly expressed in testis, skeletal muscle and heart. Weakly expressed in placenta, pancreas, spleen and peripheral blood leukocytes. 1
Induction：
Developmental stage：
Protein families：