UQCC2_MOUSE Q9CQY6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9CQY6
Recommended name：Ubiquinol-cytochrome-c reductase complex assembly factor 2
EC number：
Alternative names：(Mitochondrial nucleoid factor 1) (Mitochondrial protein M19)
Cleaved into：
GeneID：67267
Gene names (primary )：Uqcc2
Gene names (synonym )：Mnf1
Gene names (ORF )：
Length：136
Mass：16321
Sequence：MAALRYRRFLKLCEEWPVDETKRGRDLGAYLRQRVAQAFREGENTQIAEPEACDQMYESLARLHSNYYKHKYPRPRDTSFSGLSVEEYKLILSTDTLEEFQEMNKSMWKKLQEKFAPTRPEEKHKAWTRVLSRPRT
Tissue specificity：Widely expressed with highest levels in brain, liver, kidney, heart, skeletal muscle, thymus, testis and pancreas (at protein level). {ECO:0000269|PubMed:19643811}.
Induction：
Developmental stage：
Protein families：