CAH3_MOUSE   P16015


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P16015

Recommended name:Carbonic anhydrase 3

EC number:EC 4.2.1.1

Alternative names:(Carbonate dehydratase III) (Carbonic anhydrase III) (CA-III)

Cleaved into:

GeneID:12350

Gene names  (primary ):Ca3

Gene names  (synonym ):Car3

Gene names  (ORF ):

Length:260

Mass:29366

Sequence:MAKEWGYASHNGPDHWHELYPIAKGDNQSPIELHTKDIKHDPSLQPWSASYDPGSAKTILNNGKTCRVVFDDTYDRSMLRGGPLSGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHLVHWNPKYNTFGEALKQPDGIAVVGIFLKIGREKGEFQILLDALDKIKTKGKEAPFTHFDPSCLFPACRDYWTYHGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLFSSAENEPPVPLVGNWRPPQPVKGRVVRASFK

Tissue specificity:Expressed at lower levels in adipose tissue from animals that were either genetically obese or had experimentally induced obesity. {ECO:0000269|PubMed:1922100}.

Induction:

Developmental stage:

Protein families:Alpha-carbonic anhydrase family


   💬 WhatsApp