PCY2_HUMAN   Q99447


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q99447

Recommended name:Ethanolamine-phosphate cytidylyltransferase

EC number:EC:2.7.7.14

Alternative names:(CTP:phosphoethanolamine cytidylyltransferase) (Phosphorylethanolamine transferase)

Cleaved into:

GeneID:5833

Gene names  (primary ):PCYT2

Gene names  (synonym ):

Gene names  (ORF ):

Length:389

Mass:43835

Sequence:MIRNGRGAAGGAEQPGPGGRRAVRVWCDGCYDMVHYGHSNQLRQARAMGDYLIVGVHTDEEIAKHKGPPVFTQEERYKMVQAIKWVDEVVPAAPYVTTLETLDKYNCDFCVHGNDITLTVDGRDTYEEVKQAGRYRECKRTQGVSTTDLVGRMLLVTKAHHSSQEMSSEYREYADSFGKCPGGRNPWTGVSQFLQTSQKIIQFASGKEPQPGETVIYVAGAFDLFHIGHVDFLEKVHRLAERPYIIAGLHFDQEVNHYKGKNYPIMNLHERTLSVLACRYVSEVVIGAPYAVTAELLSHFKVDLVCHGKTEIIPDRDGSDPYQEPKRRGIFRQIDSGSNLTTDLIVQRIITNRLEYEARNQKKEAKELAFLEAARQQAAQPLGERDGDF

Tissue specificity:Strongest expression in liver, heart, and skeletal muscle. {ECO:0000269|PubMed:9083101}.

Induction:

Developmental stage:

Protein families:Cytidylyltransferase family


   💬 WhatsApp