CLD14_MOUSE Q9Z0S3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9Z0S3
Recommended name：Claudin-14
EC number：
Alternative names：
Cleaved into：
GeneID：56173
Gene names (primary )：Cldn14
Gene names (synonym )：
Gene names (ORF )：
Length：239
Mass：25614
Sequence：MASTAVQLLGFLLSFLGMVGTLITTILPHWRRTAHVGTNILTAVSYLKGLWMECVWHSTGIYQCQIYRSLLALPRDLQAARALMVISCLLSGMACACAVVGMKCTRCAKGTPAKTTFAVLGGALFLLAGLLCMVAVSWTTNDVVQNFYNPLLPSGMKFEIGQALYLGFISSSLSLIGGTLLCLSCQDEAPYRPYPPQSRAGATTTATAPAYRPPAAYKDNRAPSVTSAAHSGYRLNDYV
Tissue specificity：Expressed in all sensory epithelia of the inner ear vestibular organs, as well as in liver and kidney. {ECO:0000269|PubMed:11163249}.
Induction：
Developmental stage：At postnatal day 4, expression is apically located in the inner and outer hair cell region of the entire organ of Corti. By postnatal day 8, expression is highest in the supporting cells of the organ of Corti.
Protein families：Claudin family