RINI_RAT P29315
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P29315
Recommended name:Ribonuclease inhibitor 1 Publication
EC number:
Alternative names:
Cleaved into:
GeneID:100360501
Gene names (primary ):Rnh1
Gene names (synonym ):Rnh
Gene names (ORF ):
Length:456
Mass:49,974
Sequence:MSLDIQCEQLSDARWTELLPLIQQYQVVRLDDCGLTEVRCKDIRSAIQANPALTELSLRTNELGDAGVGLVLQGLQNPTCKIQKLSLQNCSLTEAGCGVLPDVLRSLSTLRELHLNDNPLGDEGLKLLCEGLRDPQCRLEKLQLEYCNLTATSCEPLASVLRVKPDFKELVLSNNDFHEAGIHTLCQGLKDSACQLESLKLENCGITSANCKDLCDVVASKASLQELDLGSNKLGNTGIAALCSGLLLPSCRLRTLWLWDCDVTAEGCKDLCRVLRAKQSLKELSLAGNELKDEGAQLLCESLLEPGCQLESLWVKTCSLTAASCPHFCSVLTKNRSLFELQMSSNPLGDSGVVELCKALGYPDTVLRVLWLGDCDVTDSGCSSLATVLLANRSLRELDLSNNCMGDNGVLQLLESLKQPSCILQQLVLYDIYWTDEVEDQLRALEEERPSLRIIS
Tissue specificity:Brain, heart, lung, liver, spleen, testes and kidney; highest in the lung and lowest in the heart. 1
Induction:
Developmental stage:
Protein families: