OMP_HUMAN   P47874


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P47874

Recommended name:Olfactory marker protein

EC number:

Alternative names:(Olfactory neuronal-specific protein)

Cleaved into:

GeneID:4975

Gene names  (primary ):OMP

Gene names  (synonym ):

Gene names  (ORF ):

Length:163

Mass:18937

Sequence:MAEDRPQQPQLDMPLVLDQGLTRQMRLRVESLKQRGEKRQDGEKLLQPAESVYRLNFTQQQRLQFERWNVVLDKPGKVTITGTSQNWTPDLTNLMTRQLLDPTAIFWRKEDSDAIDWNEADALEFGERLSDLAKIRKVMYFLVTFGEGVEPANLKASVVFNQL

Tissue specificity:Uniquely associated with mature olfactory receptor neurons.

Induction:

Developmental stage:

Protein families:Olfactory marker protein family