UCP2_MOUSE P70406
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P70406
Recommended name：Mitochondrial uncoupling protein 2
EC number：
Alternative names：(UCP 2) (Solute carrier family 25 member 8) (UCPH)
Cleaved into：
GeneID：22228
Gene names (primary )：Ucp2
Gene names (synonym )：Slc25a8
Gene names (ORF )：
Length：309
Mass：33374
Sequence：MVGFKATDVPPTATVKFLGAGTAACIADLITFPLDTAKVRLQIQGESQGLVRTAASAQYRGVLGTILTMVRTEGPRSLYNGLVAGLQRQMSFASVRIGLYDSVKQFYTKGSEHAGIGSRLLAGSTTGALAVAVAQPTDVVKVRFQAQARAGGGRRYQSTVEAYKTIAREEGIRGLWKGTSPNVARNAIVNCAELVTYDLIKDTLLKANLMTDDLPCHFTSAFGAGFCTTVIASPVDVVKTRYMNSALGQYHSAGHCALTMLRKEGPRAFYKGFMPSFLRLGSWNVVMFVTYEQLKRALMAAYQSREAPF
Tissue specificity：Highest in white adipose tissue, also detected in brown adipose tissue, heart and kidney. 4-6 times higher levels are detected in ob/ob and db/db mice.
Induction：
Developmental stage：
Protein families：Mitochondrial carrier (TC 2.A.29) family