CYTS_RAT   P19313


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P19313

Recommended name:Cystatin-S

EC number:

Alternative names:

Cleaved into:

GeneID:296234

Gene names  (primary ):Cst4

Gene names  (synonym ):Cyss

Gene names  (ORF ):

Length:141

Mass:15,949

Sequence:MAYLLHAQLFLLTTFILVLNMRLCPVLGHFLGGIEKSSMEEEGASEALNYAVNEYNEKNSDLYLSRVVEVKDVQKQVVAGTKFFFDVILGKTICLKTQGDLTNCPLNEEADQQEHEFCSFVVHDIPWENYIVLLSSSCHSI

Tissue specificity:Found in saliva, tears, urine and seminal fluid.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp