RN152_RAT D4A723
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:D4A723
Recommended name：E3 ubiquitin-protein ligase RNF152 Curated
EC number：EC:2.3.2.27
Alternative names：RING finger protein 152 Imported RING-type E3 ubiquitin transferase RNF152 Curated
Cleaved into：
GeneID：293561
Gene names (primary )：Rnf152
Gene names (synonym )：
Gene names (ORF )：
Length：203
Mass：22,356
Sequence：METLSQDSLLECQICFNYYSPRRRPKLLDCKHTCCSVCLQQMRTSQKDVRCPWCRGITKLPPGFSVSQLPDDPEVLAVIAIPHTSEHTPVFIKLPSNGCYMLPLPISKERTLLPGDMGCRLLPGSQQKSLTVVTIPAEQQPLQGGAPQEAVEEEPDRRGVAKSSTWSGVCTVILVACVLVFLLGIVLHNMSCISKRFTVISCG
Tissue specificity：
Induction：
Developmental stage：
Protein families：