MOGT2_HUMAN   Q3SYC2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q3SYC2

Recommended name:2-acylglycerol O-acyltransferase 2

EC number:EC:2.3.1.22

Alternative names:(Acyl-CoA:monoacylglycerol acyltransferase 2) (MGAT2) (hMGAT2) (Diacylglycerol O-acyltransferase candidate 5) (hDC5) (Diacylglycerol acyltransferase 2-like protein 5) (Monoacylglycerol O-acyltransferase 2)

Cleaved into:

GeneID:80168

Gene names  (primary ):MOGAT2

Gene names  (synonym ):DC5 DGAT2L5

Gene names  (ORF ):

Length:334

Mass:38196

Sequence:MVEFAPLFMPWERRLQTLAVLQFVFSFLALAEICTVGFIALLFTRFWLLTVLYAAWWYLDRDKPRQGGRHIQAIRCWTIWKYMKDYFPISLVKTAELDPSRNYIAGFHPHGVLAVGAFANLCTESTGFSSIFPGIRPHLMMLTLWFRAPFFRDYIMSAGLVTSEKESAAHILNRKGGGNLLGIIVGGAQEALDARPGSFTLLLRNRKGFVRLALTHGAPLVPIFSFGENDLFDQIPNSSGSWLRYIQNRLQKIMGISLPLFHGRGVFQYSFGLIPYRRPITTVVGKPIEVQKTLHPSEEEVNQLHQRYIKELCNLFEAHKLKFNIPADQHLEFC

Tissue specificity:Highly expressed in liver, small intestine, colon, stomach and kidney. {ECO:0000269|PubMed:12621063, ECO:0000269|PubMed:12824082}.

Induction:

Developmental stage:

Protein families:Diacylglycerol acyltransferase family


   💬 WhatsApp