MTND_RAT   Q562C9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q562C9

Recommended name:Acireductone dioxygenase UniRule Annotation

EC number:

Alternative names:

Cleaved into:

GeneID:298934

Gene names  (primary ):Adi1

Gene names  (synonym ):Alp1, Mtcbp1

Gene names  (ORF ):

Length:179

Mass:21,461

Sequence:MVQAWYMDESTADPRMPHRAQPDRPVGLEQLRTLGVLYWKLDADKYENDPELEQIRKTRNYSWMDIITICKDSLPNYEEKIKMFFEEHLHLDEEIRYILEGSGYFDVRDKEDKWIRISMEKGDMITLPAGIYHRFTLDEKNYVKAMRLFVGEPVWTPYNRPADHFDARVQYVKFLEGTA

Tissue specificity:Detected in prostate, liver, heart, brain, muscle, kidney and seminal vesicles. 1

Induction:

Developmental stage:Up-regulated by androgens in the prostate, but not in the other tissues tested. 1

Protein families:


   💬 WhatsApp