DUS11_MOUSE Q6NXK5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6NXK5
Recommended name：RNA/RNP complex-1-interacting phosphatase
EC number：EC 3.1.3.-
Alternative names：(Dual specificity protein phosphatase 11) (Phosphatase that interacts with RNA/RNP complex 1)
Cleaved into：
GeneID：72102
Gene names (primary )：Dusp11
Gene names (synonym )：Pir1
Gene names (ORF )：
Length：321
Mass：37851
Sequence：MNQHYGRHGRGRGRDFAACAPPKKKGRNHIPERWKDYLPVGQRMPGTRFIAFKVPLQKKFEAKLMPEECFSPLDLFNKIQEQNEELGLIIDLTYTQRYYKVEDLPETISYIKIFTVGHQIPDNDTIFQFKCAVKEFLKKNKNNDKLIGVHCTHGLNRTGYLICRYLIDVEGMRPDDAIELFNSCRGHCIERQNYIENLQKRHVRKNRNVSAPRTDGLEDSADPTEQVYTNNKPVKKKPRKNRRGGHLAPSQHFQHQTQSSPYSLRKWSQNQSVYQRGLVPPPGPAGEDYSQRRFFWSARPNKWTAESYQRPFYPYYWEWNL
Tissue specificity：
Induction：
Developmental stage：
Protein families：Protein-tyrosine phosphatase family, Non-receptor class dual specificity subfamily