MYCB_MOUSE   Q6P8Z1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6P8Z1

Recommended name:Protein B-Myc

EC number:

Alternative names:

Cleaved into:

GeneID:107771

Gene names  (primary ):Mycb

Gene names  (synonym ):Bmyc

Gene names  (ORF ):

Length:170

Mass:18526

Sequence:MPLHVSLANGNRDLDYDSVQPYFMCDDEEEDVHHQQPPQPPAPSEDIWKKFELLPTPRPSPGHAGLYSPPCEAVAVSFAPRDHDGDSFSIADLPELPGGDAVKQSFVCDPDDETFVKNIILQDCMWNGFSASAKLVSKLDPYQAVRKEGTGVSLAADVEPATPPDCTCNT

Tissue specificity:Highly expressed in epididymis. Also expressed in hypothalamus, pituitary, uterus and ovary. Low expression in testis. Not detected in heart. {ECO:0000269|PubMed:11039906}.

Induction:

Developmental stage:

Protein families: