SIA4B_MOUSE Q11204
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q11204
Recommended name：CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2
EC number：EC 2.4.99.4
Alternative names：(Alpha 2,3-ST 2) (Beta-galactoside alpha-2,3-sialyltransferase 2) (Gal-NAc6S) (Gal-beta-1,3-GalNAc-alpha-2,3-sialyltransferase) (Monosialoganglioside sialyltransferase) (ST3Gal II) (ST3GalII) (ST3GalA.2) (Sialyltransferase 4B) (SIAT4-B)
Cleaved into：
GeneID：20444
Gene names (primary )：St3gal2
Gene names (synonym )：Siat4b Siat5
Gene names (ORF )：
Length：350
Mass：40130
Sequence：MKCSLRVWFLSMAFLLVFIMSLLFTYSHHSMATLPYLDSGALGGTHRVKLVPGYSGLQRLGKEGLLGRNCACSRCMGDASTSEWFDSHFDGNISPVWTRDNMNLPPDVQRWWMMLQPQFKSHNTNEVLEKLFQIVPGENPYRFRDPQQCRRCAVVGNSGNLRGSGYGQEVDSHNFIMRMNQAPTVGFEKDVGSRTTHHFMYPESAKNLPANVSFVLVPFKALDLMWIASALSTGQIRFTYAPVKSFLRVDKEKVQIYNPAFFKYIHDRWTEHHGRYPSTGMLVLFFALHVCDEVNVYGFGADSRGNWHHYWENNRYAGEFRKTGVHDADFEAHIIDMLAKASKIEVYRGN
Tissue specificity：Strongly expressed in brain and liver and to a lesser extent in heart and kidney. Scarcely detectable in lung, pancreas, spleen and submaxillary gland (PubMed:8144500). Expressed in L5 dorsal root ganglion (DRG) neurons (at protein level) (PubMed:32030804). {ECO:0000269|PubMed:32030804, ECO:0000269|PubMed:8144500}.
Induction：Up-regulated in DRG neurons in response to nerve injury. {ECO:0000269|PubMed:32030804}.
Developmental stage：
Protein families：Glycosyltransferase 29 family