HXC11_MOUSE   P31313


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P31313

Recommended name:Homeobox protein Hox-C11

EC number:

Alternative names:(Homeobox protein Hox-3.7)

Cleaved into:

GeneID:109663

Gene names  (primary ):Hoxc11

Gene names  (synonym ):Hox-3.7 Hoxc-11

Gene names  (ORF ):

Length:304

Mass:33708

Sequence:MFNSVNLGNFCSPSRKERGADFGERGSCTSNLYLPSCTYYVPEFSTVSSFLPQAPSRQISYPYSAQVPPVREVSYGLEPSGKWHHRNSYSSCYAAADELMHRECLPPSTVTEILMKNEGSYGGHHHPSAPHAAPAGFYSSVNKNSVLPQAFDRFFDNAYCGGGDAPAEPPCSGKGEAKGEPEAPPASGLASRAEAGAEAEAEEENTNPSSSGSSHSATKEPAKGAAPNAPRTRKKRCPYSKFQIRELEREFFFNVYINKEKRLQLSRMLNLTDRQVKIWFQNRRMKEKKLSRDRLQYFSGNPLL

Tissue specificity:

Induction:

Developmental stage:

Protein families:Abd-B homeobox family


   💬 WhatsApp