BET1L_RAT O35152
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O35152
Recommended name：BET1-like protein
EC number：
Alternative names：
Cleaved into：
GeneID：54400
Gene names (primary )：Bet1l
Gene names (synonym )：Gs15
Gene names (ORF )：
Length：111
Mass：12,417
Sequence：MADWTRAQSSGAVEEIVDRENKRMADSLASKVTRLKSLALDIDRDTEDQNRYLDGMDSDFTSVTGLLTGSVKRFSTVARSGRDTRKLLCGMAVVLIVAFFILSYLFSRTRT
Tissue specificity：Widely expressed. Highest levels in heart, liver, skeletal muscle and kidney. 1
Induction：
Developmental stage：
Protein families：