PTGR3_MOUSE   Q8BGC4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8BGC4

Recommended name:Prostaglandin reductase-3

EC number:EC 1.3.1.48

Alternative names:(PTGR-3) (15-oxoprostaglandin 13-reductase) (Zinc-binding alcohol dehydrogenase domain-containing protein 2)

Cleaved into:

GeneID:225791

Gene names  (primary ):Zadh2

Gene names  (synonym ):Ptgr3

Gene names  (ORF ):

Length:377

Mass:40529

Sequence:MLRLAAAGARAIVDMSYARHFLDFQGSAIPRTMQKLVVTRLSPNFHEAVTLRRDCPVPLPGDGDLLVRNRFVGINASDINYSAGRYDPSLKPPFDIGFEGIGEVVALGLSASARYTVGQAVAYMAPGSFAEYTVVPASIAIPMPSVKPEYLTMLVSGTTAYLSLEELGELSEGKKVLVTAAAGGTGQFAVQLSKIAKCHVIGTCSSDEKAAFLKSIGCDRPINYRTEPVETVLKQEYPEGVDVVYESVGGAMFDLAVDALATKGRLIVIGFISGYQSPTGLSPIKAGVLPTKLLKKSASLRGFFLNHYFSKYQAAMERLLELYARGDLVCEVDLGHLAPDGRFIGLESVFQAVDYMYTGKNTGKLVVELPHPVSSKL

Tissue specificity:Widely expressed. {ECO:0000269|PubMed:23821743}.

Induction:Up-regulated by high fat diet (PubMed:19091015). Down-regulated in white adipose tissue in ob/on mice (PubMed:23821743). {ECO:0000269|PubMed:19091015, ECO:0000269|PubMed:23821743}.

Developmental stage:

Protein families:Zinc-containing alcohol dehydrogenase family, Quinone oxidoreductase subfamily


   💬 WhatsApp