CHCH2_HUMAN   Q9Y6H1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9Y6H1

Recommended name:Coiled-coil-helix-coiled-coil-helix domain-containing protein 2

EC number:

Alternative names:(Aging-associated gene 10 protein) (HCV NS2 trans-regulated protein) (NS2TP)

Cleaved into:

GeneID:51142

Gene names  (primary ):CHCHD2

Gene names  (synonym ):C7orf17

Gene names  (ORF ):AAG10

Length:151

Mass:15513

Sequence:MPRGSRSRTSRMAPPASRAPQMRAAPRPAPVAQPPAAAPPSAVGSSAAAPRQPGLMAQMATTAAGVAVGSAVGHTLGHAITGGFSGGSNAEPARPDITYQEPQGTQPAQQQQPCLYEIKQFLECAQNQGDIKLCEGFNEVLKQCRLANGLA

Tissue specificity:

Induction:Up-regulated by hypoxia (4% oxygen) (at protein level). {ECO:0000269|PubMed:23303788}.

Developmental stage:

Protein families:


   💬 WhatsApp