CHIP_RAT A6HD62
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:A6HD62
Recommended name:E3 ubiquitin-protein ligase CHIP Curated
EC number:EC:2.3.2.27
Alternative names:Carboxy terminus of Hsp70-interacting protein By Similarity RING-type E3 ubiquitin transferase CHIP Curated STIP1 homology and U box-containing protein 1 Imported
Cleaved into:
GeneID:287155
Gene names (primary ):Stub1
Gene names (synonym ):Chip 1 Publication
Gene names (ORF ):
Length:304
Mass:34,886
Sequence:MKGKEEKEGGARLGTGGGGSPDKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQESELHSYLTRLIAAERERELEECQRNHEGDEDDGHIRAQQACIEAKHDKYMADMNELFSQVDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDAFISENGWVEDY
Tissue specificity:Expressed in the adventitia layer of the carotid artery (at protein level) (PubMed:19483080). Expressed in the CA1 region of the hippocampus (at protein level) (PubMed:21808025). Expressed in the uterus (at protein level) (PubMed:21808025). 2 s
Induction:Expressed in neurons at 18.5 dpc (at protein level). 1 Publication
Developmental stage:Induced by oxygen and glucose deprivation in neuronal cells (PubMed:29934347). Induced in the neointimal layer of the carotid artery by blood flow cessation injury (PubMed:19483080). 2 s
Protein families: