ANR49_HUMAN   Q8WVL7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8WVL7

Recommended name:Ankyrin repeat domain-containing protein 49

EC number:

Alternative names:(Fetal globin-inducing factor)

Cleaved into:

GeneID:54851

Gene names  (primary ):ANKRD49

Gene names  (synonym ):FGIF

Gene names  (ORF ):

Length:239

Mass:27290

Sequence:MEKEKGNDDGIPDQENSLDFSEHFNQLELLETHGHLIPTGTQSLWVGNSDEDEEQDDKNEEWYRLQEKKMEKDPSRLLLWAAEKNRLTTVRRLLSEKATHVNTRDEDEYTPLHRAAYSGHLDIVQELIAQGADVHAVTVDGWTPLHSACKWNNTRVASFLLQHDADINAQTKGLLTPLHLAAGNRDSKDTLELLLMNRYVKPGLKNNLEETAFDIARRTSIYHYLFEIVEGCTNSSPQS

Tissue specificity:Widely expressed in fetus, at a high level in fetal liver, brain and lung. {ECO:0000269|PubMed:11162141}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp