CT47A_HUMAN   Q5JQC4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5JQC4

Recommended name:Cancer/testis antigen 47A

EC number:

Alternative names:(Cancer/testis antigen 47) (CT47)

Cleaved into:

GeneID:100507170

Gene names  (primary ):CT47A1; CT47A2; CT47A3; CT47A4; CT47A5; CT47A6; CT47A7; CT47A8; CT47A9; CT47A10; CT47A11; CT47A12

Gene names  (synonym ):CT47.1; CT47.2; CT47.3; CT47.4; CT47.5; CT47.6; CT47.7; CT47.8; CT47.9; CT47.10; CT47.11; CT47.12

Gene names  (ORF ):; ; ; ; ; ; ; ; ; ; ;

Length:288

Mass:30100

Sequence:MSATGDRHPTQGDQEAPVSQEGAQAEAAGAGNQEGGDSGPDSSDVVPAAEVVGVAGPVEGLGEEEGEQAAGLAAVPRGGSAEEDSDIGPATEEEEEEEGNEAANFDLAVVARRYPASGIHFVLLDMVHSLLHRLSHNDHILIENRQLSRLMVGPHAAARNLWGNLPPLLLPQRLGAGAAARAGEGLGLIQEAASVPEPAVPADLAEMAREPAEEAAEEKLSEEATEEPDAEEPATEEPTAQEATAPEEVTKSQPEKWDEEAQDAAGEEEKEQEKEKDAENKVKNSKGT

Tissue specificity:Strongly expressed in testis, low expression in placenta, and very low expression in brain. {ECO:0000269|PubMed:16382448}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp