CT47A_HUMAN Q5JQC4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q5JQC4
Recommended name：Cancer/testis antigen 47A
EC number：
Alternative names：(Cancer/testis antigen 47) (CT47)
Cleaved into：
GeneID：100507170
Gene names (primary )：CT47A1; CT47A2; CT47A3; CT47A4; CT47A5; CT47A6; CT47A7; CT47A8; CT47A9; CT47A10; CT47A11; CT47A12
Gene names (synonym )：CT47.1; CT47.2; CT47.3; CT47.4; CT47.5; CT47.6; CT47.7; CT47.8; CT47.9; CT47.10; CT47.11; CT47.12
Gene names (ORF )：; ; ; ; ; ; ; ; ; ; ;
Length：288
Mass：30100
Sequence：MSATGDRHPTQGDQEAPVSQEGAQAEAAGAGNQEGGDSGPDSSDVVPAAEVVGVAGPVEGLGEEEGEQAAGLAAVPRGGSAEEDSDIGPATEEEEEEEGNEAANFDLAVVARRYPASGIHFVLLDMVHSLLHRLSHNDHILIENRQLSRLMVGPHAAARNLWGNLPPLLLPQRLGAGAAARAGEGLGLIQEAASVPEPAVPADLAEMAREPAEEAAEEKLSEEATEEPDAEEPATEEPTAQEATAPEEVTKSQPEKWDEEAQDAAGEEEKEQEKEKDAENKVKNSKGT
Tissue specificity：Strongly expressed in testis, low expression in placenta, and very low expression in brain. {ECO:0000269|PubMed:16382448}.
Induction：
Developmental stage：
Protein families：