ATPO_RAT   Q06647


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q06647

Recommended name:ATP synthase peripheral stalk subunit OSCP, mitochondrial Curated

EC number:

Alternative names:

Cleaved into:

GeneID:192241

Gene names  (primary ):Atp5po

Gene names  (synonym ):Atp5o

Gene names  (ORF ):

Length:213

Mass:23,398

Sequence:MAAPATSVLSRQVRSFSTSVVRPFSKLVRPPVQVYGIEGRYATALYSAASKQKRLDQVEKELLRVGQLLKDPKVSLAVLNPYIKRSIKVKSLKDITTKEKFSPLTANLMNLLAENGRLGNTQGVISAFSTIMSVHRGEVPCTVTTAFPLDEAVLSELKTVLNSFLSKGQILNLEVKTDPSIMGGMIVRIGEKYVDMSAKSKIQKLSKAMRDLL

Tissue specificity:Expressed by the principal cells of the epididymis. Detected in flagella of epididymal sperm (at protein level). 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp