B2L11_MOUSE O54918
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O54918
Recommended name：Bcl-2-like protein 11
EC number：
Alternative names：(Bcl2-L-11) (Bcl2-interacting mediator of cell death)
Cleaved into：
GeneID：12125
Gene names (primary )：Bcl2l11
Gene names (synonym )：Bim
Gene names (ORF )：
Length：196
Mass：22067
Sequence：MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQGNPDGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEEPEDLRPEIRIAQELRRIGDEFNETYTRRVFANDYREAEDHPQMVILQLLRFIFRLVWRRH
Tissue specificity：Expressed in a number of B- and T-lymphoid cell lines. {ECO:0000269|PubMed:9430630}.
Induction：By ER stress. {ECO:0000269|PubMed:21159964}.
Developmental stage：
Protein families：Bcl-2 family