EI2BD_RAT Q63186
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q63186
Recommended name：Translation initiation factor eIF2B subunit delta
EC number：
Alternative names：
Cleaved into：
GeneID：117019
Gene names (primary )：Eif2b4
Gene names (synonym )：Eif2bd
Gene names (ORF )：
Length：524
Mass：57,809
Sequence：MAAVAVAVREESRSEMKTELSPRPGAAGRELTQEEKLQLRKEKKQQKKKRKEEKGADQEIGSAVSAAQRQDPVRELQGTGSQLGGTTGEKLPAGRSKAELRAERRAKQEAERALKQARKGEQGGPSPQACPSTAGEATSGVKRVPEHTQADDPTLLRRLLRKPDRQQVPTRKDYGSKVSLFSHLPQYSRQSSLTQYMSIPSSVIHPAMVRLGLQYSQGLVSGSNARCIALLHALQQVIQDYTTPPNEELSRDLVNKLKPYISFLTQCRPMSASMCNAIKFFNKEVTGMSSSKREEEAKSELKEAIDRYVQEKIVLASQAISRFASKKISDGDVILVYGCSSLVSRILQEAWVEGRRFRVVVVDSRPRLEGRHMLHCLVRAGVPTSYLLIPAASYVLPEVSKVLLGAHALLANGSVMSRVGTAQLALVARAHNVPVLVCCETYKFCERVQTDAFVSNELDDPDDLQCKRGDQVTLANWQNNSSLRLLNLVYDVTPPELVDLVITELGMIPCSSVPVVLRVKSSDQ
Tissue specificity：
Induction：
Developmental stage：
Protein families：