CAMLG_RAT   Q6DGG9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6DGG9

Recommended name:Guided entry of tail-anchored proteins factor CAMLG Curated

EC number:

Alternative names:

Cleaved into:

GeneID:81715

Gene names  (primary ):Camlg

Gene names  (synonym ):Caml 1 Publication, Get2 By Similarity

Gene names  (ORF ):

Length:295

Mass:32,790

Sequence:MEPMPSATDGGDRSATPSGLSASQRRAELRRRKLLMNSEQRINRIMGFHRPGSGAEEENQTKSKPLDSDILNPLGVPSVSKRVVLGDSVDGGVTDYQPSGGADIRGAQLGDKLDSFIKAPECSSKDGVELRQRNRGDLTADSAPRGSHHGLEQYLSRFEEAMKLRKQLISEKPSQEDGRTTEEFDSFRIFRLVGCALLALVVRAFVCKYLSIFAPFLTLQLAYMGLYKYFPKGEKKVKTTVLTAALLLSGIPAEVINRSMDTYSKMGEVFTDLCVYFFTFIFCHEVLEYWGPEVP

Tissue specificity:In the central nervous system, expressed in astrocytes, microglia and neurons (at protein level). 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp