CLYBL_HUMAN   Q8N0X4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8N0X4

Recommended name:Citramalyl-CoA lyase, mitochondrial

EC number:EC:4.1.3.25

Alternative names:((3S)-malyl-CoA thioesterase) (Beta-methylmalate synthase) (Citrate lyase subunit beta-like protein) (Citrate lyase beta-like) (Malate synthase)

Cleaved into:

GeneID:171425

Gene names  (primary ):CLYBL

Gene names  (synonym ):CLB

Gene names  (ORF ):

Length:340

Mass:37359

Sequence:MALRLLRRAARGAAAAALLRLKASLAADIPRLGYSSSSHHKYIPRRAVLYVPGNDEKKIKKIPSLNVDCAVLDCEDGVAANKKNEARLRIVKTLEDIDLGPTEKCVRVNSVSSGLAEEDLETLLQSRVLPSSLMLPKVESPEEIQWFADKFSFHLKGRKLEQPMNLIPFVETAMGLLNFKAVCEETLKVGPQVGLFLDAVVFGGEDFRASIGATSSKETLDILYARQKIVVIAKAFGLQAIDLVYIDFRDGAGLLRQSREGAAMGFTGKQVIHPNQIAVVQEQFSPSPEKIKWAEELIAAFKEHQQLGKGAFTFQGSMIDMPLLKQAQNTVTLATSIKEK

Tissue specificity:

Induction:

Developmental stage:

Protein families:HpcH/HpaI aldolase family, Citrate lyase beta subunit-like subfamily


   💬 WhatsApp