HXD10_HUMAN   P28358


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P28358

Recommended name:Homeobox protein Hox-D10

EC number:

Alternative names:(Homeobox protein Hox-4D) (Homeobox protein Hox-4E)

Cleaved into:

GeneID:3236

Gene names  (primary ):HOXD10

Gene names  (synonym ):HOX4D HOX4E

Gene names  (ORF ):

Length:340

Mass:38411

Sequence:MSFPNSSPAANTFLVDSLISACRSDSFYSSSASMYMPPPSADMGTYGMQTCGLLPSLAKREVNHQNMGMNVHPYIPQVDSWTDPNRSCRIEQPVTQQVPTCSFTTNIKEESNCCMYSDKRNKLISAEVPSYQRLVPESCPVENPEVPVPGYFRLSQTYATGKTQEYNNSPEGSSTVMLQLNPRGAAKPQLSAAQLQMEKKMNEPVSGQEPTKVSQVESPEAKGGLPEERSCLAEVSVSSPEVQEKESKEEIKSDTPTSNWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISKSVNLTDRQVKIWFQNRRMKLKKMSRENRIRELTANLTFS

Tissue specificity:Strongly expressed in the adult male and female urogenital tracts.

Induction:

Developmental stage:Expressed in the developing limb buds.

Protein families:Abd-B homeobox family


   💬 WhatsApp