FAM3C_HUMAN   Q92520


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q92520

Recommended name:Protein FAM3C

EC number:

Alternative names:(Interleukin-like EMT inducer)

Cleaved into:

GeneID:10447

Gene names  (primary ):FAM3C

Gene names  (synonym ):ILEI

Gene names  (ORF ):GS3786

Length:227

Mass:24680

Sequence:MRVAGAAKLVVAVAVFLLTFYVISQVFEIKMDASLGNLFARSALDTAARSTKPPRYKCGISKACPEKHFAFKMASGAANVVGPKICLEDNVLMSGVKNNVGRGINVALANGKTGEVLDTKYFDMWGGDVAPFIEFLKAIQDGTIVLMGTYDDGATKLNDEARRLIADLGSTSITNLGFRDNWVFCGGKGIKTKSPFEQHIKNNKDTNKYEGWPEVVEMEGCIPQKQD

Tissue specificity:Present in most secretory epithelia (at protein level). {ECO:0000269|PubMed:16959614}.

Induction:

Developmental stage:

Protein families:FAM3 family


   💬 WhatsApp