FXYD5_MOUSE P97808
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P97808
Recommended name:FXYD domain-containing ion transport regulator 5
EC number:
Alternative names:(EF-8) (Ion channel homolog RIC) (Oncoprotein-induced protein 2)
Cleaved into:
GeneID:18301
Gene names (primary ):Fxyd5
Gene names (synonym ):Oit2
Gene names (ORF ):
Length:178
Mass:19454
Sequence:MSLSSRLCLLTIVALILPSRGQTPKKPTSIFTADQTSATTRDNVPDPDQTSPGVQTTPLIWTREEATGSQTAAQTETQQLTKMATSNPVSDPGPHTSSKKGTPAVSRIEPLSPSKNFMPPSYIEHPLDSNENNPFYYDDTTLRKRGLLVAAVLFITGIIILTSGKCRQLSQFCLNRHR
Tissue specificity:Spleen, lung, skeletal muscle, and testis.
Induction:
Developmental stage:Exhibits biphasic expression during development.
Protein families:FXYD family