SBK3_HUMAN   P0C264


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P0C264

Recommended name:Uncharacterized serine/threonine-protein kinase SBK3

EC number:EC:2.7.11.1

Alternative names:(SH3-binding domain kinase family member 3) (Sugen kinase 110)

Cleaved into:

GeneID:100130827

Gene names  (primary ):SBK3

Gene names  (synonym ):SGK110

Gene names  (ORF ):

Length:359

Mass:38488

Sequence:MERRASETPEDGDPEEDTATALQRLVELTTSRVTPVRSLRDQYHLIRKLGSGSYGRVLLAQPHQGGPAVALKLLRRDLVLRSTFLREFCVGRCVSAHPGLLQTLAGPLQTPRYFAFAQEYAPCGDLSGMLQERGLPELLVKRVVAQLAGALDFLHSRGLVHADVKPDNVLVFDPVCSRVALGDLGLTRPEGSPTPAPPVPLPTAPPELCLLLPPDTLPLRPAVDSWGLGVLLFCAATACFPWDVALAPNPEFEAFAGWVTTKPQPPQPPPPWDQFAPPALALLQGLLDLDPETRSPPLAVLDFLGDDWGLQGNREGPGVLGSAVSYEDREEGGSSLEEWTDEGDDSKSGGRTGTDGGAP

Tissue specificity:

Induction:

Developmental stage:

Protein families:Protein kinase superfamily, Ser/Thr protein kinase family, STKL subfamily


   💬 WhatsApp