HXC10_MOUSE P31257
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P31257
Recommended name：Homeobox protein Hox-C10
EC number：
Alternative names：(Homeobox protein Hox-3.6)
Cleaved into：
GeneID：209448
Gene names (primary )：Hoxc10
Gene names (synonym )：Hox-3.6 Hoxc-10
Gene names (ORF )：
Length：342
Mass：38196
Sequence：MTCPRNVTPNSYAEPLAAPGGGERYNRNAGMYMQSGSDFNCGVMRGCGLAPSLSKRDEGGSPNLALNTYPSYLSQLDSWGDPKAAYRLEQPVGRPLSSCSYPPSVKEENVCCMYSAEKRAKSGPEAALYSHPLPESCLGEHEVPVPSYYRASPSYSALDKTPHCAGANEFEAPFEQRASLNPRTEHLESPQLGGKVSFPETPKSDSQTPSPNEIKTEQSLAGPKASPSESEKERAKTADSSPDTSDNEAKEEIKAENTTGNWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISKTINLTDRQVKIWFQNRRMKLKKMNRENRIRELTSNFNFT
Tissue specificity：
Induction：
Developmental stage：
Protein families：Abd-B homeobox family