CNIH3_HUMAN   Q8TBE1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8TBE1

Recommended name:Protein cornichon homolog 3

EC number:

Alternative names:(CNIH-3) (Cornichon family AMPA receptor auxiliary protein 3)

Cleaved into:

GeneID:149111

Gene names  (primary ):CNIH3

Gene names  (synonym ):

Gene names  (ORF ):

Length:160

Mass:18976

Sequence:MAFTFAAFCYMLSLVLCAALIFFAIWHIIAFDELRTDFKSPIDQCNPVHARERLRNIERICFLLRKLVLPEYSIHSLFCIMFLCAQEWLTLGLNVPLLFYHFWRYFHCPADSSELAYDPPVVMNADTLSYCQKEAWCKLAFYLLSFFYYLYCMIYTLVSS

Tissue specificity:Expression is up-regulated in dorsolateral prefrontal cortex of patients with schizophrenia (postmortem brain study). {ECO:0000269|PubMed:23103966}.

Induction:

Developmental stage:

Protein families:Cornichon family


   💬 WhatsApp