RALYL_HUMAN Q86SE5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q86SE5
Recommended name：RNA-binding Raly-like protein
EC number：
Alternative names：(hRALYL) (Heterogeneous nuclear ribonucleoprotein C-like 3) (hnRNP core protein C-like 3)
Cleaved into：
GeneID：138046
Gene names (primary )：RALYL
Gene names (synonym )：HNRPCL3
Gene names (ORF )：
Length：291
Mass：32331
Sequence：MTGKTQTSNVTNKNDPKSINSRVFIGNLNTAIVKKVDIEAIFSKYGKIVGCSVHKGYAFVQYMSERHARAAVAGENARVIAGQPLDINMAGEPKPYRPKPGNKRPLSALYRLESKEPFLSVGGYVFDYDYYRDDFYNRLFDYHGRVPPPPRAVIPLKRPRVAVTTTRRGKGVFSMKGGSRSTASGSTGSKLKSDELQTIKKELTQIKTKIDSLLGRLEKIEKQQKAEAEAQKKQLEESLVLIQEECVSEIADHSTEEPAEGGPDADGEEMTDGIEEDFDEDGGHELFLQIK
Tissue specificity：Widely expressed, with highest levels in brain. {ECO:0000269|PubMed:12688537}.
Induction：
Developmental stage：
Protein families：RRM HNRPC family, RALY subfamily