SPCS1_HUMAN   Q9Y6A9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9Y6A9

Recommended name:Signal peptidase complex subunit 1

EC number:EC:3.4.-.-

Alternative names:(Microsomal signal peptidase 12 kDa subunit) (SPase 12 kDa subunit)

Cleaved into:

GeneID:28972

Gene names  (primary ):SPCS1

Gene names  (synonym ):SPC12

Gene names  (ORF ):HSPC033

Length:169

Mass:18298

Sequence:MARGGDTGCTGPSETSASGAAAIALPGLEGPATDAQCQTLPLTVLKSRSPSPRSLPPALSCPPPQPAMLEHLSSLPTQMDYKGQKLAEQMFQGIILFSAIVGFIYGYVAEQFGWTVYIVMAGFAFSCLLTLPPWPIYRRHPLKWLPVQESSTDDKKPGERKIKRHAKNN

Tissue specificity:

Induction:

Developmental stage:

Protein families:SPCS1 family


   💬 WhatsApp