BARX2_MOUSE   O08686


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O08686

Recommended name:Homeobox protein BarH-like 2

EC number:

Alternative names:

Cleaved into:

GeneID:12023

Gene names  (primary ):Barx2

Gene names  (synonym ):

Gene names  (ORF ):

Length:283

Mass:31534

Sequence:MHCHAELRLSSPGQLKAARRRYKTFMIDEILSKETCDYFEKLSLYSVCPSLVVRPKPLHSCTGSPSLRAYPLLSVITRQPTVISHLVPTGSGLTPVLTRHPVAAAEAAAAAAETPGGEALASSESETEQPTPRQKKPRRSRTIFTELQLMGLEKKFQKQKYLSTPDRLDLAQSLGLTQLQVKTWYQNRRMKWKKMVLKGGQEAPTKPKGRPKKNSIPTSEEIEAEEKMNSQAQSQELLESSERQEEPCDTQEPKACLVPLEVAEPIHQPQELSEASSEPPPLS

Tissue specificity:Nervous system, particularly in the telencephalon, spinal cord, and dorsal root ganglia.

Induction:

Developmental stage:Highly expressed in small groups of cells undergoing tissue remodeling, such as ectodermal cells within indentations surrounding the eye and maxillo-nasal groove and in the first branchial pouch, lung buds, precartilagenous condensations, and mesenchyme of the limb. At 9.5 dpc, expressed only to head, prominent in the region of telencephalon and mesencephalon, and concentrated in cells along the dorsal midline. At 10.5 dpc, expression is moderated in the most rostral regions of the head, but particularly prominent in a lateral band of cells in the periocular region. At 11.5 dpc, detected in the telencephalon, frontonasal region and limbs. At 12.5 dpc, expressed in the telencephalon and hindbrain.

Protein families:BAR homeobox family


   💬 WhatsApp