K1B27_MOUSE Q9JM71
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JM71
Recommended name：Kallikrein 1-related peptidase b27
EC number：EC 3.4.21.-
Alternative names：(Glandular kallikrein K27) (mGK-27) (Tissue kallikrein 27) (mKlk27)
Cleaved into：
GeneID：16619
Gene names (primary )：Klk1b27
Gene names (synonym )：Klk-27 Klk27
Gene names (ORF )：
Length：263
Mass：28742
Sequence：MRFLILFLALSLGGIDAAPPVQSRIIGGFKCKKNSQPWHVAVLRSNKYICGGVLLDPNWVLTAAHCYGNDTSQHNVWLGKNKLFQREPSAQHRWVSKSFPHPDYNMSLLNDHIPHPEDKSNDLMLLRLSKPADITDAVKPIDLPTEEPKLGSTCLASGWGSITPTKYQIPNDLQCVFIKLLPNENCAKAYVHKVTDVMLCVGETGGGKGTCKGDSGGPLICDGVLHGITSWGSIPCAKPNAPGVFTKLIKFTSWIKDTMAKNP
Tissue specificity：Expressed in testis and submaxillary gland. Not expressed in heart, brain, spleen, lung, liver, muscle, kidney and ovary. In the testis, expression localized specifically to Leydig cells in the interstitial tissues. {ECO:0000269|PubMed:11082197}.
Induction：
Developmental stage：Detectable in testis 4 weeks after birth, becoming more prominent thereafter. {ECO:0000269|PubMed:11082197}.
Protein families：Peptidase S1 family, Kallikrein subfamily