HPBP1_HUMAN   Q9NZL4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9NZL4

Recommended name:Hsp70-binding protein 1

EC number:

Alternative names:(HspBP1) (Heat shock protein-binding protein 1) (Hsp70-binding protein 2) (HspBP2) (Hsp70-interacting protein 1) (Hsp70-interacting protein 2)

Cleaved into:

GeneID:23640

Gene names  (primary ):HSPBP1

Gene names  (synonym ):HSPBP

Gene names  (ORF ):PP1845

Length:359

Mass:39303

Sequence:MSDEGSRGSRLPLALPPASQGCSSGGGGGGSSAGGSGNSRPPRNLQGLLQMAITAGSEEPDPPPEPMSEERRQWLQEAMSAAFRGQREEVEQMKSCLRVLSQPMPPTAGEAEQAADQQEREGALELLADLCENMDNAADFCQLSGMHLLVGRYLEAGAAGLRWRAAQLIGTCSQNVAAIQEQVLGLGALRKLLRLLDRDACDTVRVKALFAISCLVREQEAGLLQFLRLDGFSVLMRAMQQQVQKLKVKSAFLLQNLLVGHPEHKGTLCSMGMVQQLVALVRTEHSPFHEHVLGALCSLVTDFPQGVRECREPELGLEELLRHRCQLLQQHEEYQEELEFCEKLLQTCFSSPADDSMDR

Tissue specificity:Ubiquitous. {ECO:0000269|PubMed:9830037}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp