NRSN1_MOUSE   P97799


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P97799

Recommended name:Neurensin-1

EC number:

Alternative names:(Neuro-p24) (Vesicular membrane protein of 24 kDa) (Vesicular membrane protein p24)

Cleaved into:

GeneID:22360

Gene names  (primary ):Nrsn1

Gene names  (synonym ):Vmp

Gene names  (ORF ):

Length:196

Mass:21595

Sequence:MTSCSNTCGSRRAQADTEGGYQQRYGVRSYLHQFYEDCTASIWEYEDDFQIQRSPNRWSSVFWKVGLISGTVFVILGLTVLAVGFLVPPKIEAFGEADFMVVDTHAVKYNGALDTCKLAGAVLFCIGGTSMAGCLLMSVFAKSYSKEEKFLQQKFKERIADIKAHTQPITKAPGPGDTKIPVTLSRVQNVQPLSAT

Tissue specificity:Expressed predominantly in brain. Also weakly expressed in lung and spleen. In brain, expressed strongly in nerve fibers of the cerebral cortex, anterior cerebral nuclei, hypothalamus, amygdaloid complex, brain stem of the metaencephalon and medulla oblongata, and moderately expressed in soma of neurons of the dentate gyrus of the hippocampus and Purkinje cells of the cerebellum. {ECO:0000269|PubMed:9191101}.

Induction:By retinoic acid in neuroblastoma Neuro2a cells. Down-regulated following fear conditioning (at protein level) (PubMed:26430118). {ECO:0000269|PubMed:16527258, ECO:0000269|PubMed:26430118, ECO:0000269|PubMed:9191101}.

Developmental stage:Expression is developmentally regulated as axonal fibers innervate, extend collateral fibers and finally attain a stable state. First detected at postnatal day 6 in cell bodies and apical dendrites of pyramidal neurons in the developing cerebral cortex, with expression gradually increasing during postnatal development. In P1 retina, strongly expressed in the optic nerve fiber layer, and weakly expressed in ganglion cells, presumptive amacrine and horizontal cells. At P10, also strongly expressed in other parts of the retina such as the ganglion cells, inner plexiform layer and horizontal cells. Expression decreases as the retina develops further to maturity. {ECO:0000269|PubMed:12445626, ECO:0000269|PubMed:16696124}.

Protein families:VMP family


   💬 WhatsApp