PDK1_HUMAN   Q15118


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q15118

Recommended name:[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial

EC number:EC:2.7.11.2

Alternative names:(Pyruvate dehydrogenase kinase isoform 1) (PDH kinase 1)

Cleaved into:

GeneID:5163

Gene names  (primary ):PDK1

Gene names  (synonym ):PDHK1

Gene names  (ORF ):

Length:436

Mass:49244

Sequence:MRLARLLRGAALAGPGPGLRAAGFSRSFSSDSGSSPASERGVPGQVDFYARFSPSPLSMKQFLDFGSVNACEKTSFMFLRQELPVRLANIMKEISLLPDNLLRTPSVQLVQSWYIQSLQELLDFKDKSAEDAKAIYDFTDTVIRIRNRHNDVIPTMAQGVIEYKESFGVDPVTSQNVQYFLDRFYMSRISIRMLLNQHSLLFGGKGKGSPSHRKHIGSINPNCNVLEVIKDGYENARRLCDLYYINSPELELEELNAKSPGQPIQVVYVPSHLYHMVFELFKNAMRATMEHHANRGVYPPIQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMYSTAPRPRVETSRAVPLAGFGYGLPISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTDSIERLPVYNKAAWKHYNTNHEADDWCVPSREPKDMTTFRSA

Tissue specificity:Expressed predominantly in the heart. Detected at lower levels in liver, skeletal muscle and pancreas. {ECO:0000269|PubMed:7499431}.

Induction:Up-regulated via the HIF1A signaling pathway in response to hypoxia. {ECO:0000269|PubMed:21763680}.

Developmental stage:

Protein families:PDK/BCKDK protein kinase family


   💬 WhatsApp