C99L2_HUMAN   Q8TCZ2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8TCZ2

Recommended name:CD99 antigen-like protein 2

EC number:

Alternative names:(MIC2-like protein 1) (CD antigen CD99)

Cleaved into:

GeneID:83692

Gene names  (primary ):CD99L2

Gene names  (synonym ):MIC2L1

Gene names  (ORF ):UNQ1964/PRO4486

Length:262

Mass:27986

Sequence:MVAWRSAFLVCLAFSLATLVQRGSGDFDDFNLEDAVKETSSVKQPWDHTTTTTTNRPGTTRAPAKPPGSGLDLADALDDQDDGRRKPGIGGRERWNHVTTTTKRPVTTRAPANTLGNDFDLADALDDRNDRDDGRRKPIAGGGGFSDKDLEDIVGGGEYKPDKGKGDGRYGSNDDPGSGMVAEPGTIAGVASALAMALIGAVSSYISYQQKKFCFSIQQGLNADYVKGENLEAVVCEEPQVKYSTLHTQSAEPPPPPEPARI

Tissue specificity:Expressed in many tissues, with low expression in thymus. {ECO:0000269|PubMed:12706889}.

Induction:

Developmental stage:

Protein families:CD99 family


   💬 WhatsApp