S10A4_HUMAN   P26447


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P26447

Recommended name:Protein S100-A4

EC number:

Alternative names:(Calvasculin) (Metastasin) (Placental calcium-binding protein) (Protein Mts1) (S100 calcium-binding protein A4)

Cleaved into:

GeneID:6275

Gene names  (primary ):S100A4

Gene names  (synonym ):CAPL MTS1

Gene names  (ORF ):

Length:101

Mass:11729

Sequence:MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK

Tissue specificity:Ubiquitously expressed.

Induction:

Developmental stage:

Protein families:S-100 family


   💬 WhatsApp