UXT_HUMAN Q9UBK9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9UBK9
Recommended name：Protein UXT
EC number：
Alternative names：(Androgen receptor trapped clone 27 protein) (ART-27) (Ubiquitously expressed transcript protein)
Cleaved into：
GeneID：8409
Gene names (primary )：UXT
Gene names (synonym )：
Gene names (ORF )：HSPC024
Length：157
Mass：18246
Sequence：MATPPKRRAVEATGEKVLRYETFISDVLQRDLRKVLDHRDKVYEQLAKYLQLRNVIERLQEAKHSELYMQVDLGCNFFVDTVVPDTSRIYVALGYGFFLELTLAEALKFIDRKSSLLTELSNSLTKDSMNIKAHIHMLLEGLRELQGLQNFPEKPHH
Tissue specificity：Ubiquitous (PubMed:10087202, PubMed:11854421, PubMed:17635584, PubMed:11827465). Expressed in prostate epithelial cells (PubMed:21730289). Expressed in mammary epithelial cells (PubMed:28106301). Highest levels in the heart, skeletal muscle, pancreas, kidney, liver, adrenal gland, peripheral blood leukocytes, lymph node, prostate, and thyroid and the lowest levels in bladder and uterus (PubMed:11854421, PubMed:17635584, PubMed:11827465). Overexpressed in a number of tumor tissues (PubMed:11854421, PubMed:16221885, PubMed:28106301). {ECO:0000269|PubMed:10087202, ECO:0000269|PubMed:11827465, ECO:0000269|PubMed:11854421, ECO:0000269|PubMed:16221885, ECO:0000269|PubMed:17635584, ECO:0000269|PubMed:21730289, ECO:0000269|PubMed:28106301}.
Induction：
Developmental stage：
Protein families：UXT family