IFNE_MOUSE   Q80ZF2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q80ZF2

Recommended name:Interferon epsilon

EC number:

Alternative names:(IFN-epsilon) (Interferon epsilon-1) (Interferon tau-1)

Cleaved into:

GeneID:230405

Gene names  (primary ):Ifne

Gene names  (synonym ):Ifne1 Ifnt1

Gene names  (ORF ):

Length:192

Mass:22372

Sequence:MVHRQLPETVLLLLVSSTIFSLEPKRIPFQLWMNRESLQLLKPLPSSSVQQCLAHRKNFLLPQQPVSPHQYQEGQVLAVVHEILQQIFTLLQTHGTMGIWEENHIEKVLAALHRQLEYVESLGGLNAAQKSGGSSAQNLRLQIKAYFRRIHDYLENQRYSSCAWIIVQTEIHRCMFFVFRFTTWLSRQDPDP

Tissue specificity:Expressed at very high levels in uterus and, at much lower levels, in ovary and cervix. Very low levels, if any, in other organs. In the endometrium, expressed in the luminal and glandular epithelial cells (at protein level). {ECO:0000269|PubMed:15233997, ECO:0000269|PubMed:23449591}.

Induction:By estrogens. Contrary to other type I interferons, not induced by known pattern-recognition receptor pathways. {ECO:0000269|PubMed:23449591}.

Developmental stage:Expression varies approximately 30-fold during the estrous cycle, with lowest levels during diestrus and highest at estrus. During pregnancy, uterine expression is dramatically reduced at 1.5 dpc and reaches its lowest levels at 4.5 dpc, coincident with the time of embryo implantation. {ECO:0000269|PubMed:23449591}.

Protein families:Alpha/beta interferon family


   💬 WhatsApp