VGLU1_MOUSE Q3TXX4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q3TXX4
Recommended name：Vesicular glutamate transporter 1
EC number：
Alternative names：(VGluT1) (Brain-specific Na(+)-dependent inorganic phosphate cotransporter) (Solute carrier family 17 member 7)
Cleaved into：
GeneID：72961
Gene names (primary )：Slc17a7
Gene names (synonym )：Bnpi Vglut1
Gene names (ORF )：
Length：560
Mass：61637
Sequence：MEFRQEEFRKLAGRALGRLHRLLEKRQEGAETLELSADGRPVTTHTRDPPVVDCTCFGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNSTTHRGGHVVVQKAQFNWDPETVGLIHGSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSTLNMLIPSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSVFYVYGSFGIFWYLFWLLVSYESPALHPSISEEERKYIEDAIGESAKLMNPVTKFNTPWRRFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLVSALPHLVMTIIVPIGGQIADFLRSRHIMSTTNVRKLMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKHKTREEWQYVFLIASLVHYGGVIFYGVFASGEKQPWAEPEEMSEEKCGFVGHDQLAGSDESEMEDEAEPPGAPPAPPPSYGATHSTVQPPRPPPPVRDY
Tissue specificity：Expressed in hippocampus (at protein level). Expressed in the molecular layer of the cerebellum and in retina. {ECO:0000269|PubMed:15103023, ECO:0000269|PubMed:16595674, ECO:0000269|PubMed:17611277, ECO:0000269|PubMed:24153177}.
Induction：Oscillates diurnally in synaptic vesicles (at protein level). {ECO:0000269|PubMed:16595674}.
Developmental stage：Expression in brain increases progressively from four days to adulthood. {ECO:0000269|PubMed:12384506, ECO:0000269|PubMed:15118123}.
Protein families：Major facilitator superfamily, Sodium/anion cotransporter family, VGLUT subfamily