RMI2_HUMAN   Q96E14


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q96E14

Recommended name:RecQ-mediated genome instability protein 2

EC number:

Alternative names:(hRMI2) (BLM-associated protein of 18 kDa) (BLAP18)

Cleaved into:

GeneID:116028

Gene names  (primary ):RMI2

Gene names  (synonym ):C16orf75

Gene names  (ORF ):

Length:147

Mass:15865

Sequence:MAAAADSFSGGPAGVRLPRSPPLKVLAEQLRRDAEGGPGAWRLSRAAAGRGPLDLAAVWMQGRVVMADRGEARLRDPSGDFSVRGLERVPRGRPCLVPGKYVMVMGVVQACSPEPCLQAVKMTDLSDNPIHESMWELEVEDLHRNIP

Tissue specificity:

Induction:

Developmental stage:

Protein families:RMI2 family


   💬 WhatsApp