TAF12_MOUSE   Q8VE65


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8VE65

Recommended name:Transcription initiation factor TFIID subunit 12

EC number:

Alternative names:(Transcription initiation factor TFIID 20 kDa subunits) (TAFII-20) (TAFII20)

Cleaved into:

GeneID:66464

Gene names  (primary ):Taf12

Gene names  (synonym ):

Gene names  (ORF ):

Length:161

Mass:17875

Sequence:MNQFGPSALINLSSFSSVKPEPASTPPQGSMANSTTVGKIAGTPGTGGRLSPENNQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK

Tissue specificity:

Induction:

Developmental stage:

Protein families:TAF12 family


   💬 WhatsApp