F183B_MOUSE Q5NC57
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q5NC57
Recommended name：Protein FAM183B
EC number：
Alternative names：
Cleaved into：
GeneID：75429
Gene names (primary )：Fam183b
Gene names (synonym )：
Gene names (ORF )：
Length：135
Mass：16125
Sequence：MAGRVGQMKNQDEVHQNQILRELFLKELRAQKLYTQYHVNPLRKVHTITRKPMSWHDNLEEPEDAKFLNLIHHAAQGPKKKYSETQTEAQEIGWDPNPLINPDRQDHRLNHFRVYHDITLYKAKLWSLGEDDHQK
Tissue specificity：Predominantly expressed in tissues containing motile cilia. {ECO:0000269|PubMed:27914912}.
Induction：Expression is activated by FOXJ1 and NOTO. {ECO:0000269|PubMed:27914912}.
Developmental stage：Expressed in the developing fetal lung epithelium and embryonic ventral node (at protein level). {ECO:0000269|PubMed:27914912}.
Protein families：FAM183 family